PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1697
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 340aa    MW: 37809.3 Da    PI: 5.0979
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1697genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.3e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
      Gh_D08G1697 15 KGPWTPEEDQKLVDCINKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.33.1e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+  ++++++ lG++ W++Ia++++ gRt++++k++w++
      Gh_D08G1697  68 RGKFTEEEERVIINLHAVLGNK-WSRIAAHLP-GRTDNEIKNYWNT 111
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.5261062IPR017930Myb domain
SuperFamilySSF466898.81E-3312109IPR009057Homeodomain-like
SMARTSM007174.1E-161464IPR001005SANT/Myb domain
PfamPF002494.4E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-251669IPR009057Homeodomain-like
CDDcd001672.78E-121762No hitNo description
PROSITE profilePS5129428.16163117IPR017930Myb domain
SMARTSM007171.1E-1567115IPR001005SANT/Myb domain
PfamPF002491.1E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2770117IPR009057Homeodomain-like
CDDcd001674.86E-1270111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRSPCCAED ANLKKGPWTP EEDQKLVDCI NKHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FTEEEERVII NLHAVLGNKW SRIAAHLPGR TDNEIKNYWN TQIRKKLLNM  120
GIDPQTHKPR TDLNHLLNLS QLLCASQLGN LMNPWDTAFK LQVDAAQLAK TQLLQNLLKI  180
INTNKPETVD TAGFLGSQNP YPIEGLLGGT STLSDKELAP TPENVTNNAG ATSQTSTDFQ  240
ALEDPCAYFG NGFNYESNLG MNNQSLSNSF EQTENPLPEL VSASLGQTSS INQTDDKTET  300
APDSTIYEAW DKLIMEDEAD GSYWKEILDL TSSSSSPISW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32121174108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475675.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0D2S2090.0A0A0D2S209_G
STRINGPOPTR_0003s09300.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-86myb domain protein 9